Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Adenylate kinase [52554] (16 species) |
Species Methanococcus thermolithotrophicus [TaxId:2186] [89661] (2 PDB entries) |
Domain d6hf7c_: 6hf7 C: [370125] automated match to d1ki9a_ complexed with 7mt, gol, mg, tb |
PDB Entry: 6hf7 (more details), 1.96 Å
SCOPe Domain Sequences for d6hf7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hf7c_ c.37.1.1 (C:) Adenylate kinase {Methanococcus thermolithotrophicus [TaxId: 2186]} knklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmrk ldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiivv etsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnlld yaveelisvlr
Timeline for d6hf7c_: