Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Listeria monocytogenes [TaxId:1639] [369549] (2 PDB entries) |
Domain d6abqb_: 6abq B: [369583] Other proteins in same PDB: d6abqa2 automated match to d4esba_ complexed with cl |
PDB Entry: 6abq (more details), 2.3 Å
SCOPe Domain Sequences for d6abqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6abqb_ a.4.5.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]} gltellkgslegmilerisrgetygyeitkylndlgfdeivegtvytilvrlekkglvei ekkkselgpprkfytlspageeelaifwkrwdfiqgkimqvkggqa
Timeline for d6abqb_: