Lineage for d6abqb_ (6abq B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. Protein automated matches [190154] (91 species)
    not a true protein
  7. Species Listeria monocytogenes [TaxId:1639] [369549] (2 PDB entries)
  8. Domain d6abqb_: 6abq B: [369583]
    Other proteins in same PDB: d6abqa2
    automated match to d4esba_
    complexed with cl

Details for d6abqb_

PDB Entry: 6abq (more details), 2.3 Å

PDB Description: crystal structure of transcription factor from listeria monocytogenes
PDB Compounds: (B:) PadR family transcriptional regulator

SCOPe Domain Sequences for d6abqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6abqb_ a.4.5.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
gltellkgslegmilerisrgetygyeitkylndlgfdeivegtvytilvrlekkglvei
ekkkselgpprkfytlspageeelaifwkrwdfiqgkimqvkggqa

SCOPe Domain Coordinates for d6abqb_ are not available.

Timeline for d6abqb_:

Domains from other chains:
(mouse over for more information)
d6abqa1, d6abqa2