Lineage for d6abqa1 (6abq A:1-105)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (87 species)
    not a true protein
  7. 3069487Species Listeria monocytogenes [TaxId:1639] [369549] (2 PDB entries)
  8. 3069501Domain d6abqa1: 6abq A:1-105 [369563]
    Other proteins in same PDB: d6abqa2
    automated match to d4esba_
    complexed with cl

Details for d6abqa1

PDB Entry: 6abq (more details), 2.3 Å

PDB Description: crystal structure of transcription factor from listeria monocytogenes
PDB Compounds: (A:) PadR family transcriptional regulator

SCOPe Domain Sequences for d6abqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6abqa1 a.4.5.0 (A:1-105) automated matches {Listeria monocytogenes [TaxId: 1639]}
mkgltellkgslegmilerisrgetygyeitkylndlgfdeivegtvytilvrlekkglv
eiekkkselgpprkfytlspageeelaifwkrwdfiqgkimqvkg

SCOPe Domain Coordinates for d6abqa1:

Click to download the PDB-style file with coordinates for d6abqa1.
(The format of our PDB-style files is described here.)

Timeline for d6abqa1:

  • d6abqa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6abqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6abqb_