SCOPe 2.08: Domain d6nema1: 6nem A:1-195

Lineage for d6nema1 (6nem A:1-195)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)

8. Domain d6nema1: 6nem A:1-195 [368472]
   Other proteins in same PDB: d6nema2
   automated match to d4nfza_
   complexed with kks, mn, so4

Details for d6nema1

PDB Entry: 6nem, 1.95 Å

PDB Description: 3-hydroxy-5-[(naphthalen-1-yl)methyl]-6-[4-(1h-tetrazol-5-yl) phenyl]pyridin-2(1h)-one bound to influenza 2009 ph1n1 endonuclease

PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d6nema1:

Sequence; same for both SEQRES and ATOM records:

>d6nema1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqse

Timeline for d6nema1:

• d6nema1 first appeared in SCOPe 2.07