Lineage for d6q4ra4 (6q4r A:615-937)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726102Domain d6q4ra4: 6q4r A:615-937 [367593]
    Other proteins in same PDB: d6q4ra1, d6q4ra2, d6q4ra3
    automated match to d2xdta4
    complexed with b3p, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra4

PDB Entry: 6q4r (more details), 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q4ra4 a.118.1.0 (A:615-937) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlqsek

SCOPe Domain Coordinates for d6q4ra4:

Click to download the PDB-style file with coordinates for d6q4ra4.
(The format of our PDB-style files is described here.)

Timeline for d6q4ra4: