Lineage for d5zbza_ (5zbz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870741Protein Initiation factor 4a [52706] (2 species)
    homologous to UvrB
  7. 2870749Species Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries)
    Uniprot P60842 21-238
    4A-I
  8. 2870750Domain d5zbza_: 5zbz A: [365219]
    automated match to d2g9na1
    complexed with mli, sau

Details for d5zbza_

PDB Entry: 5zbz (more details), 1.31 Å

PDB Description: crystal structure of the dead domain of human eif4a with sanguinarine
PDB Compounds: (A:) Eukaryotic initiation factor 4A-I

SCOPe Domain Sequences for d5zbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zbza_ c.37.1.19 (A:) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
gviesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgt
gktatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnv
raevqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydif
qklnsntqvvllsatmpsdvlevtkkfmrdpirilvkk

SCOPe Domain Coordinates for d5zbza_:

Click to download the PDB-style file with coordinates for d5zbza_.
(The format of our PDB-style files is described here.)

Timeline for d5zbza_: