PDB entry 5zbz

View 5zbz on RCSB PDB site
Description: Crystal structure of the DEAD domain of Human eIF4A with sanguinarine
Class: hydrolase
Keywords: eukaryotic translation initiation factor 4A, sanguinarine, inhibitor, TRANSLATION, HYDROLASE
Deposited on 2018-02-14, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic initiation factor 4A-I
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF4A1, DDX2A, EIF4A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zbza_
  • Heterogens: SAU, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zbzA (A:)
    gegviesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqs
    gtgktatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggt
    nvraevqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiyd
    ifqklnsntqvvllsatmpsdvlevtkkfmrdpirilvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zbzA (A:)
    gviesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgt
    gktatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnv
    raevqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydif
    qklnsntqvvllsatmpsdvlevtkkfmrdpirilvkk