SCOPe 2.08: Domain d6d8zc2: 6d8z C:2152-2273

Lineage for d6d8zc2 (6d8z C:2152-2273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Triple functional domain protein TRIO [110264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110265] (3 PDB entries)
   Uniprot O75962 1231-1535

8. Domain d6d8zc2: 6d8z C:2152-2273 [365028]
   Other proteins in same PDB: d6d8za1, d6d8zb1, d6d8zb3, d6d8zc1
   automated match to d1ntya2

Details for d6d8zc2

PDB Entry: 6d8z, 2.65 Å

PDB Description: crystal structure of the c-terminal guanine nucleotide exchange factor module of human trio

PDB Compounds: (C:) triple functional domain protein

SCOPe Domain Sequences for d6d8zc2:

Sequence, based on SEQRES records:

>d6d8zc2 b.55.1.1 (C:2152-2273) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
qgfdgkivaqgklllqdtflvtdqdagllprcrerriflfeqivifsepldkkkgfsmpg
flfknsikvsclcleenvendpckfaltsrtgdvvetfilhssspsvrqtwiheinqile
nq

Sequence, based on observed residues (ATOM records):

>d6d8zc2 b.55.1.1 (C:2152-2273) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
qgfdgkivaqgklllqdtflvtdqrcrerriflfeqivifsepldkkkgfsmpgflfkns
ikvsclcleenvendpckfaltsrtgdvvetfilhssspsvrqtwiheinqilenq

Timeline for d6d8zc2:

• d6d8zc2 first appeared in SCOPe 2.07