Lineage for d6d8zb1 (6d8z B:1960-2151)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719622Protein Triple functional domain protein TRIO [109935] (1 species)
  7. 2719623Species Human (Homo sapiens) [TaxId:9606] [109936] (3 PDB entries)
    Uniprot O75962 1231-1535
  8. 2719627Domain d6d8zb1: 6d8z B:1960-2151 [365062]
    Other proteins in same PDB: d6d8za2, d6d8zb2, d6d8zb3, d6d8zc2
    automated match to d1ntya1

Details for d6d8zb1

PDB Entry: 6d8z (more details), 2.65 Å

PDB Description: crystal structure of the c-terminal guanine nucleotide exchange factor module of human trio
PDB Compounds: (B:) triple functional domain protein

SCOPe Domain Sequences for d6d8zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8zb1 a.87.1.1 (B:1960-2151) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
eerkssslkrrhyvlqelveterdyvrdlgyvvegymalmkedgvpddmkgkdkivfgni
hqiydwhrdfflgelekcledpeklgslfvkherrlhmyiaycqnkpksehivseyidtf
fedlkqrlghrlqltdllikpvqrimkyqlllkdflkyskkasldtseleravevmcivp
rrcndmmnvgrl

SCOPe Domain Coordinates for d6d8zb1:

Click to download the PDB-style file with coordinates for d6d8zb1.
(The format of our PDB-style files is described here.)

Timeline for d6d8zb1: