Lineage for d6d8zb2 (6d8z B:2152-2272)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803326Protein Triple functional domain protein TRIO [110264] (1 species)
  7. 2803327Species Human (Homo sapiens) [TaxId:9606] [110265] (3 PDB entries)
    Uniprot O75962 1231-1535
  8. 2803331Domain d6d8zb2: 6d8z B:2152-2272 [365063]
    Other proteins in same PDB: d6d8za1, d6d8zb1, d6d8zb3, d6d8zc1
    automated match to d1ntya2

Details for d6d8zb2

PDB Entry: 6d8z (more details), 2.65 Å

PDB Description: crystal structure of the c-terminal guanine nucleotide exchange factor module of human trio
PDB Compounds: (B:) triple functional domain protein

SCOPe Domain Sequences for d6d8zb2:

Sequence, based on SEQRES records: (download)

>d6d8zb2 b.55.1.1 (B:2152-2272) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
qgfdgkivaqgklllqdtflvtdqdagllprcrerriflfeqivifsepldkkkgfsmpg
flfknsikvsclcleenvendpckfaltsrtgdvvetfilhssspsvrqtwiheinqile
n

Sequence, based on observed residues (ATOM records): (download)

>d6d8zb2 b.55.1.1 (B:2152-2272) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
qgfdgkivaqgklllqdtflvtdqrcrerriflfeqivifsepldkkkgfsmpgflfkns
ikvsclcleenvendpckfaltsrtgdvvetfilhssspsvrqtwiheinqilen

SCOPe Domain Coordinates for d6d8zb2:

Click to download the PDB-style file with coordinates for d6d8zb2.
(The format of our PDB-style files is described here.)

Timeline for d6d8zb2: