SCOPe 2.08: Domain d6iw5d1: 6iw5 D:1-295

Lineage for d6iw5d1 (6iw5 D:1-295)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries)

8. Domain d6iw5d1: 6iw5 D:1-295 [364900]
   Other proteins in same PDB: d6iw5a2, d6iw5b2, d6iw5c2, d6iw5d2
   automated match to d3p54a1

Details for d6iw5d1

PDB Entry: 6iw5, 2.5 Å

PDB Description: crystal structure of yfv-china se in prefusion state

PDB Compounds: (D:) envelope protein

SCOPe Domain Sequences for d6iw5d1:

Sequence; same for both SEQRES and ATOM records:

>d6iw5d1 f.10.1.0 (D:1-295) automated matches {Yellow fever virus [TaxId: 11089]}
ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgt

Timeline for d6iw5d1:

• d6iw5d1 first appeared in SCOPe 2.07