Lineage for d3p54a1 (3p54 A:1-299)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
2 intertwined domains; all-beta and alpha+betaSuperfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) 
Family f.10.1.0: automated matches [227258] (1 protein)
not a true familyProtein automated matches [227047] (11 species)
not a true proteinSpecies Japanese encephalitis virus [TaxId:11072] [226036] (1 PDB entry) 
Domain d3p54a1: 3p54 A:1-299 [214662]
Other proteins in same PDB: d3p54a2
automated match to d1urza2
Details for d3p54a1
PDB Entry: 3p54 (more details), 2.1 Å
PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.
PDB Compounds: (A:) Envelope glycoproteinSCOPe Domain Sequences for d3p54a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p54a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus [TaxId: 11072]}
fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl
gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgt
SCOPe Domain Coordinates for d3p54a1:
Click to download the PDB-style file with coordinates for d3p54a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p54a1:
- d3p54a1 first appeared in SCOPe 2.03
- d3p54a1 appears in SCOPe 2.07
View in 3D
