SCOPe 2.08: Domain d6iw5b2: 6iw5 B:296-393

Lineage for d6iw5b2 (6iw5 B:296-393)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries)

8. Domain d6iw5b2: 6iw5 B:296-393 [364843]
   Other proteins in same PDB: d6iw5a1, d6iw5b1, d6iw5c1, d6iw5d1
   automated match to d3p54a2

Details for d6iw5b2

PDB Entry: 6iw5, 2.5 Å

PDB Description: crystal structure of yfv-china se in prefusion state

PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d6iw5b2:

Sequence; same for both SEQRES and ATOM records:

>d6iw5b2 b.1.18.0 (B:296-393) automated matches {Yellow fever virus [TaxId: 11089]}
sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpi
astnddevlievnppfgdsyiivgtgdsrltyqwhkeg

Timeline for d6iw5b2:

• d6iw5b2 first appeared in SCOPe 2.07