![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Yellow fever virus [TaxId:11089] [255299] (4 PDB entries) |
![]() | Domain d6iw5b2: 6iw5 B:296-393 [364843] Other proteins in same PDB: d6iw5a1, d6iw5b1, d6iw5c1, d6iw5d1 automated match to d3p54a2 |
PDB Entry: 6iw5 (more details), 2.5 Å
SCOPe Domain Sequences for d6iw5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iw5b2 b.1.18.0 (B:296-393) automated matches {Yellow fever virus [TaxId: 11089]} sykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaavnkgilvtvnpi astnddevlievnppfgdsyiivgtgdsrltyqwhkeg
Timeline for d6iw5b2: