SCOPe 2.08: Domain d6fhgb_: 6fhg B:

Lineage for d6fhgb_ (6fhg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (10 species)
   not a true protein

7. Species Thermus phage [TaxId:1542447] [363153] (1 PDB entry)

8. Domain d6fhgb_: 6fhg B: [363156]
   automated match to d5dwfa_
   complexed with zn

Details for d6fhgb_

PDB Entry: 6fhg, 1.95 Å

PDB Description: crystal structure of the ts2631 endolysin from thermus scotoductus phage with the unique n-terminal moiety responsible for peptidoglycan anchoring

PDB Compounds: (B:) LysT endolysin

SCOPe Domain Sequences for d6fhgb_:

Sequence; same for both SEQRES and ATOM records:

>d6fhgb_ d.118.1.0 (B:) automated matches {Thermus phage [TaxId: 1542447]}
mrilepwnrwyrqkrayrvrltpihyvvlhhtagpenqtpeaikryheeargwphigyhy
lvyrdgrvyktlpnnavpicvrefnpvsicvaavgdfsagvwpddapgwralwelkqala
kaypkalfvlhknlvptecpgrltweliqrkgg

Timeline for d6fhgb_:

• d6fhgb_ first appeared in SCOPe 2.07