Lineage for d6fhga_ (6fhg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973069Species Thermus phage [TaxId:1542447] [363153] (1 PDB entry)
  8. 2973070Domain d6fhga_: 6fhg A: [363154]
    automated match to d5dwfa_
    complexed with zn

Details for d6fhga_

PDB Entry: 6fhg (more details), 1.95 Å

PDB Description: crystal structure of the ts2631 endolysin from thermus scotoductus phage with the unique n-terminal moiety responsible for peptidoglycan anchoring
PDB Compounds: (A:) LysT endolysin

SCOPe Domain Sequences for d6fhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhga_ d.118.1.0 (A:) automated matches {Thermus phage [TaxId: 1542447]}
mrilepwnrwyrqkrayrvrltpihyvvlhhtagpenqtpeaikryheeargwphigyhy
lvyrdgrvyktlpnnavpicvrefnpvsicvaavgdfsagvwpddapgwralwelkqala
kaypkalfvlhknlvptecpgrltweliqrkggggq

SCOPe Domain Coordinates for d6fhga_:

Click to download the PDB-style file with coordinates for d6fhga_.
(The format of our PDB-style files is described here.)

Timeline for d6fhga_: