Lineage for d5dwfa_ (5dwf A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. Protein automated matches [190549] (4 species)
    not a true protein
  7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (39 PDB entries)
  8. Domain d5dwfa_: 5dwf A: [278101]
    automated match to d3ng4a_
    complexed with edo, gol, tla

Details for d5dwfa_

PDB Entry: 5dwf (more details), 1.83 Å

PDB Description: crystal structure of the complex of peptidoglycan recognition protein, pgrp-s from camel with ethylene glycol at 1.83 a resolution
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d5dwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dwfa_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
cgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnlg
wcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraaq
nllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d5dwfa_ are not available.

Timeline for d5dwfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5dwfb_, d5dwfc_, d5dwfd_