PDB entry 6fhg

View 6fhg on RCSB PDB site
Description: Crystal structure of the Ts2631 endolysin from Thermus scotoductus phage with the unique N-terminal moiety responsible for peptidoglycan anchoring
Class: antimicrobial protein
Keywords: Endolysin, thermophilic, N-terminal domain, T7-like fold, ANTIMICROBIAL PROTEIN
Deposited on 2018-01-14, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysT endolysin
    Species: Thermus phage 2631 [TaxId:1542447]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhga_
  • Chain 'B':
    Compound: LysT endolysin
    Species: Thermus phage 2631 [TaxId:1542447]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhgb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fhgA (A:)
    mrilepwnrwyrqkrayrvrltpihyvvlhhtagpenqtpeaikryheeargwphigyhy
    lvyrdgrvyktlpnnavpicvrefnpvsicvaavgdfsagvwpddapgwralwelkqala
    kaypkalfvlhknlvptecpgrltweliqrkggggq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fhgB (B:)
    mrilepwnrwyrqkrayrvrltpihyvvlhhtagpenqtpeaikryheeargwphigyhy
    lvyrdgrvyktlpnnavpicvrefnpvsicvaavgdfsagvwpddapgwralwelkqala
    kaypkalfvlhknlvptecpgrltweliqrkggggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhgB (B:)
    mrilepwnrwyrqkrayrvrltpihyvvlhhtagpenqtpeaikryheeargwphigyhy
    lvyrdgrvyktlpnnavpicvrefnpvsicvaavgdfsagvwpddapgwralwelkqala
    kaypkalfvlhknlvptecpgrltweliqrkgg