Lineage for d6ml1c1 (6ml1 C:-1-82)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (8 species)
  7. 2501491Species Human (Homo sapiens) [TaxId:9606] [54239] (253 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 3062978Domain d6ml1c1: 6ml1 C:-1-82 [363040]
    Other proteins in same PDB: d6ml1a_, d6ml1c2, d6ml1e2
    automated match to d3rula_
    complexed with ca, cl, edo, mes, na, zn

Details for d6ml1c1

PDB Entry: 6ml1 (more details), 1.9 Å

PDB Description: structure of the usp15 deubiquitinase domain in complex with an affinity-matured inhibitory ubv
PDB Compounds: (C:) Ubiquitin variant 15.1a

SCOPe Domain Sequences for d6ml1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ml1c1 d.15.1.1 (C:-1-82) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkqle
dgrtlsdyniqkhstlqllvisrg

SCOPe Domain Coordinates for d6ml1c1:

Click to download the PDB-style file with coordinates for d6ml1c1.
(The format of our PDB-style files is described here.)

Timeline for d6ml1c1:

  • d6ml1c1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-24