PDB entry 6ml1

View 6ml1 on RCSB PDB site
Description: Structure of the USP15 deubiquitinase domain in complex with an affinity-matured inhibitory Ubv
Class: signaling protein
Keywords: deubiuqitination, Ubv, high-affinity, inhibition, SIGNALING PROTEIN
Deposited on 2018-09-26, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 15,Ubiquitin carboxyl-terminal hydrolase 15,Ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-282)
      • linker (283)
    • Uniprot Q9Y4E8 (284-End)
    Domains in SCOPe 2.07: d6ml1a_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 15,Ubiquitin carboxyl-terminal hydrolase 15,Ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-282)
      • linker (283)
    • Uniprot Q9Y4E8 (284-End)
      • expression tag (346-348)
  • Chain 'C':
    Compound: Ubiquitin variant 15.1a
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0L7RG06 (Start-84)
      • insertion (1)
      • conflict (2)
      • conflict (4)
      • conflict (11)
      • conflict (14)
      • conflict (16)
      • conflict (21)
      • conflict (49-50)
      • conflict (53)
      • conflict (55-56)
      • conflict (73)
      • conflict (77)
      • conflict (79-82)
      • expression tag (85-87)
    Domains in SCOPe 2.07: d6ml1c1, d6ml1c2
  • Chain 'E':
    Compound: Ubiquitin variant 15.1a
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0L7RG06 (Start-84)
      • insertion (1)
      • conflict (2)
      • conflict (4)
      • conflict (11)
      • conflict (14)
      • conflict (16)
      • conflict (21)
      • conflict (53)
      • conflict (55-56)
      • conflict (73)
      • conflict (77)
      • conflict (79-82)
      • expression tag (85-86)
    Domains in SCOPe 2.07: d6ml1e1, d6ml1e2
  • Chain 'G':
    Compound: Proteolyzed N-terminal tag of Ubv.15.1a construct
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ML1 (0-End)
  • Heterogens: CA, ZN, NA, EDO, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ml1A (A:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmsgcrynliavsnhyggmg
    gghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml1A (A:)
    neqpglcglsnlgfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeiaksyael
    ikqmwsgkfsyvtprafktqvgrfapqfcqellaflldglhedlnrirkkpyiqlkdadg
    rpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfdpfcyltlplpmpk
    kpfvklkdcielfttkeklgdpwycpnckehqqatkkldlwslppvlvvhlkrfsysrym
    rdkldtlvdfpindldmsgcrynliavsnhygghytafaknkddgkwyyfddssvstase
    dqivskaayvlfyqrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ml1C (C:)
    gaamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkql
    edgrtlsdyniqkhstlqllvisrgilygssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml1C (C:)
    aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkqle
    dgrtlsdyniqkhstlqllvisrgily
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ml1E (E:)
    gaamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkql
    edgrtlsdyniqkhstlqllvisrgilygssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml1E (E:)
    aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifalsfyrkqledgr
    tlsdyniqkhstlqllvisrgil
    

  • Chain 'G':
    No sequence available.