SCOPe 2.08: Domain d6ml1e1: 6ml1 E:-1-82

Lineage for d6ml1e1 (6ml1 E:-1-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d6ml1e1: 6ml1 E:-1-82 [362791]
   Other proteins in same PDB: d6ml1a_, d6ml1c2, d6ml1e2
   automated match to d3rula_
   complexed with ca, cl, edo, mes, na, zn

Details for d6ml1e1

PDB Entry: 6ml1, 1.9 Å

PDB Description: structure of the usp15 deubiquitinase domain in complex with an affinity-matured inhibitory ubv

PDB Compounds: (E:) Ubiquitin variant 15.1a

SCOPe Domain Sequences for d6ml1e1:

Sequence, based on SEQRES records:

>d6ml1e1 d.15.1.1 (E:-1-82) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifagkrlsfyrkqle
dgrtlsdyniqkhstlqllvisrg

Sequence, based on observed residues (ATOM records):

>d6ml1e1 d.15.1.1 (E:-1-82) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
aamlifvktlsgkfislevepsdtienvkakiqdkegippdqqrlifalsfyrkqledgr
tlsdyniqkhstlqllvisrg

Timeline for d6ml1e1:

• d6ml1e1 first appeared in SCOPe 2.07