Lineage for d6a0pa1 (6a0p A:0-299)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022872Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 3022873Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 3022918Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 3022919Protein automated matches [227047] (11 species)
    not a true protein
  7. 3022940Species Usutu virus [TaxId:64286] [361607] (1 PDB entry)
  8. 3022941Domain d6a0pa1: 6a0p A:0-299 [361609]
    Other proteins in same PDB: d6a0pa2, d6a0pa3
    automated match to d3p54a1

Details for d6a0pa1

PDB Entry: 6a0p (more details), 2 Å

PDB Description: crystal structure of usutu virus envelope protein in the pre-fusion state
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6a0pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a0pa1 f.10.1.0 (A:0-299) automated matches {Usutu virus [TaxId: 64286]}
mfnclgmsnrdflegvsgatwvdvvlegdscitimakdkptidikmmeteatnlaevrsy
cylatvsdvstvsncpttgeahnpkraedtyvcksgvtdrgwgngcglfgkgsidtcanf
tcslkamgrmiqpenvkyevgifihgstssdthgnyssqlgasqagrftitpnspaitvk
mgdygeisveceprnglnteayyimsvgtkhflvhrewfndlalpwtspassnwrnreil
lefeephatkqsvvalgsqegalhqalagavpvsfsgsvkltsghlkcrvkmekltlkgt

SCOPe Domain Coordinates for d6a0pa1:

Click to download the PDB-style file with coordinates for d6a0pa1.
(The format of our PDB-style files is described here.)

Timeline for d6a0pa1: