Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Usutu virus [TaxId:64286] [361607] (1 PDB entry) |
Domain d6a0pa1: 6a0p A:0-299 [361609] Other proteins in same PDB: d6a0pa2, d6a0pa3 automated match to d3p54a1 |
PDB Entry: 6a0p (more details), 2 Å
SCOPe Domain Sequences for d6a0pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a0pa1 f.10.1.0 (A:0-299) automated matches {Usutu virus [TaxId: 64286]} mfnclgmsnrdflegvsgatwvdvvlegdscitimakdkptidikmmeteatnlaevrsy cylatvsdvstvsncpttgeahnpkraedtyvcksgvtdrgwgngcglfgkgsidtcanf tcslkamgrmiqpenvkyevgifihgstssdthgnyssqlgasqagrftitpnspaitvk mgdygeisveceprnglnteayyimsvgtkhflvhrewfndlalpwtspassnwrnreil lefeephatkqsvvalgsqegalhqalagavpvsfsgsvkltsghlkcrvkmekltlkgt
Timeline for d6a0pa1: