Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Usutu virus [TaxId:64286] [361610] (1 PDB entry) |
Domain d6a0pa2: 6a0p A:300-406 [361611] Other proteins in same PDB: d6a0pa1, d6a0pa3 automated match to d3p54a2 |
PDB Entry: 6a0p (more details), 2 Å
SCOPe Domain Sequences for d6a0pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a0pa2 b.1.18.0 (A:300-406) automated matches {Usutu virus [TaxId: 64286]} tygmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvtanp yvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkagssigka
Timeline for d6a0pa2: