SCOPe 2.08: Domain d6a0pa2: 6a0p A:300-406

Lineage for d6a0pa2 (6a0p A:300-406)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Usutu virus [TaxId:64286] [361610] (1 PDB entry)

8. Domain d6a0pa2: 6a0p A:300-406 [361611]
   Other proteins in same PDB: d6a0pa1, d6a0pa3
   automated match to d3p54a2

Details for d6a0pa2

PDB Entry: 6a0p, 2 Å

PDB Description: crystal structure of usutu virus envelope protein in the pre-fusion state

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6a0pa2:

Sequence; same for both SEQRES and ATOM records:

>d6a0pa2 b.1.18.0 (A:300-406) automated matches {Usutu virus [TaxId: 64286]}
tygmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvtanp
yvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkagssigka

Timeline for d6a0pa2:

• d6a0pa2 first appeared in SCOPe 2.07