Lineage for d6h9bd2 (6h9b D:246-441)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (19 PDB entries)
  8. 3061392Domain d6h9bd2: 6h9b D:246-441 [361454]
    Other proteins in same PDB: d6h9ba1, d6h9bb1, d6h9bc1, d6h9bd1, d6h9be_
    automated match to d3rycd2
    complexed with fwh, gdp, gtp, mg, so4

Details for d6h9bd2

PDB Entry: 6h9b (more details), 2.75 Å

PDB Description: 1,1-diheterocyclic ethylenes derived from quinaldine and carbazole as new tubulin polymerization inhibitors: synthesis, metabolism, and biological evaluation
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d6h9bd2:

Sequence, based on SEQRES records: (download)

>d6h9bd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d6h9bd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqltvpeltqqmfdsknmmaacdprh
gryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkmsstf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
atad

SCOPe Domain Coordinates for d6h9bd2:

Click to download the PDB-style file with coordinates for d6h9bd2.
(The format of our PDB-style files is described here.)

Timeline for d6h9bd2:

  • d6h9bd2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-20