SCOPe 2.08: Domain d6h9be_: 6h9b E:

Lineage for d6h9be_ (6h9b E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d6h9be_: 6h9b E: [361427]
   Other proteins in same PDB: d6h9ba1, d6h9ba2, d6h9bb1, d6h9bb2, d6h9bc1, d6h9bc2, d6h9bd1, d6h9bd2
   automated match to d4i55e_
   complexed with fwh, gdp, gtp, mg, so4

Details for d6h9be_

PDB Entry: 6h9b, 2.75 Å

PDB Description: 1,1-diheterocyclic ethylenes derived from quinaldine and carbazole as new tubulin polymerization inhibitors: synthesis, metabolism, and biological evaluation

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6h9be_:

Sequence, based on SEQRES records:

>d6h9be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records):

>d6h9be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelkeeasr

Timeline for d6h9be_:

• d6h9be_ first appeared in SCOPe 2.07