Lineage for d6h9be_ (6h9b E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734099Domain d6h9be_: 6h9b E: [361427]
    Other proteins in same PDB: d6h9ba1, d6h9ba2, d6h9bb1, d6h9bb2, d6h9bc1, d6h9bc2, d6h9bd1, d6h9bd2
    automated match to d4i55e_
    complexed with fwh, gdp, gtp, mg, so4

Details for d6h9be_

PDB Entry: 6h9b (more details), 2.75 Å

PDB Description: 1,1-diheterocyclic ethylenes derived from quinaldine and carbazole as new tubulin polymerization inhibitors: synthesis, metabolism, and biological evaluation
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6h9be_:

Sequence, based on SEQRES records: (download)

>d6h9be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records): (download)

>d6h9be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelkeeasr

SCOPe Domain Coordinates for d6h9be_:

Click to download the PDB-style file with coordinates for d6h9be_.
(The format of our PDB-style files is described here.)

Timeline for d6h9be_: