Lineage for d6h9bb1 (6h9b B:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2864059Species Sheep (Ovis aries) [TaxId:9940] [224884] (15 PDB entries)
  8. 2864096Domain d6h9bb1: 6h9b B:1-245 [361436]
    Other proteins in same PDB: d6h9ba2, d6h9bb2, d6h9bc2, d6h9bd2, d6h9be_
    automated match to d4drxb1
    complexed with fwh, gdp, gtp, mg, so4

Details for d6h9bb1

PDB Entry: 6h9b (more details), 2.75 Å

PDB Description: 1,1-diheterocyclic ethylenes derived from quinaldine and carbazole as new tubulin polymerization inhibitors: synthesis, metabolism, and biological evaluation
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d6h9bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9bb1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6h9bb1:

Click to download the PDB-style file with coordinates for d6h9bb1.
(The format of our PDB-style files is described here.)

Timeline for d6h9bb1: