PDB entry 6h9b

View 6h9b on RCSB PDB site
Description: 1,1-Diheterocyclic Ethylenes Derived from Quinaldine and Carbazole as New Tubulin Polymerization Inhibitors: Synthesis, Metabolism, and Biological Evaluation
Class: transport protein
Keywords: cytoskeleton, cell division, intracellular transport, TRANSPORT PROTEIN
Deposited on 2018-08-03, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H9B (0-End)
    Domains in SCOPe 2.07: d6h9ba1, d6h9ba2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H9B (0-430)
    Domains in SCOPe 2.07: d6h9bb1, d6h9bb2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H9B (0-432)
    Domains in SCOPe 2.07: d6h9bc1, d6h9bc2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • PDB 6H9B (0-430)
    Domains in SCOPe 2.07: d6h9bd1, d6h9bd2
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043 (0-141)
      • conflict (0)
      • engineered mutation (10)
      • engineered mutation (16)
    Domains in SCOPe 2.07: d6h9be_
  • Heterogens: FWH, SO4, GTP, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h9bA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravf
    vdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirklad
    qctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyns
    iltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslrfdga
    lnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdp
    rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
    lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
    lekdyeevgvdsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9bA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravf
    vdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirklad
    qctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyns
    iltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslrfdga
    lnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdp
    rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
    lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
    lekdyeevgvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9bB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprg
    lkmsstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9bC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsddsfntffsetgagkhvpravf
    vdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirklad
    qctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyns
    iltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssitaslrfdga
    lnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdp
    rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
    lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
    lekdyeevgvdsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6h9bD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprg
    lkmsstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9bD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqltvpeltqqmfdsknmmaacd
    prhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkms
    stfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
    yqdatad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6h9bE (E:)
    admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9bE (E:)
    admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
    khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
    aeevrknkelkeeasr