SCOPe 2.08: Domain d6go8a1: 6go8 A:1-233

Lineage for d6go8a1 (6go8 A:1-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d6go8a1: 6go8 A:1-233 [361416]
   Other proteins in same PDB: d6go8a2
   automated match to d3srya_
   complexed with mpd, mrd

Details for d6go8a1

PDB Entry: 6go8, 1.65 Å

PDB Description: structure of gfpmut2 crystallized at ph 6

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6go8a1:

Sequence; same for both SEQRES and ATOM records:

>d6go8a1 d.22.1.1 (A:1-233) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgm

Timeline for d6go8a1:

• d6go8a1 first appeared in SCOPe 2.07