Lineage for d3srya_ (3sry A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein Green fluorescent protein, GFP [54513] (6 species)
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (282 PDB entries)
    Uniprot P42212
  8. Domain d3srya_: 3sry A: [216530]
    automated match to d3st2a_

Details for d3srya_

PDB Entry: 3sry (more details), 1.1600000000000001 Å

PDB Description: engineered high-affinity halide-binding protein derived from yfp: halide-free
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3srya_:

Sequence, based on SEQRES records: (download)

>d3srya_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttfgygvqcfarypdhmrqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
dhyaqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdely

Sequence, based on observed residues (ATOM records): (download)

>d3srya_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttfgygvqcfarypdhmrqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
dhyaqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitely

SCOPe Domain Coordinates for d3srya_ are not available.

Timeline for d3srya_: