Lineage for d6gqha_ (6gqh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940144Domain d6gqha_: 6gqh A: [361408]
    automated match to d3srya_
    complexed with ca

Details for d6gqha_

PDB Entry: 6gqh (more details), 2.4 Å

PDB Description: structure of gfpmut2 crystallized at ph 8.5 and transferred to ph 6
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d6gqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gqha_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d6gqha_:

Click to download the PDB-style file with coordinates for d6gqha_.
(The format of our PDB-style files is described here.)

Timeline for d6gqha_: