Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Family c.95.1.2: Chalcone synthase [53914] (2 proteins) |
Protein Pyrone synthase (PyS, chalcone synthase 2) [53917] (1 species) |
Species Gerbera hybrida [53918] (2 PDB entries) |
Domain d1qlvb2: 1qlv B:236-393 [36014] |
PDB Entry: 1qlv (more details), 2.1 Å
SCOP Domain Sequences for d1qlvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlvb2 c.95.1.2 (B:236-393) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrida} averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvr
Timeline for d1qlvb2: