Lineage for d1qlvb2 (1qlv B:236-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. Protein Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain [419039] (1 species)
  7. Species Gerbera hybrid cultivar [TaxId:18101] [419523] (2 PDB entries)
  8. 2917271Domain d1qlvb2: 1qlv B:236-393 [36014]
    Other proteins in same PDB: d1qlva1, d1qlvb1

Details for d1qlvb2

PDB Entry: 1qlv (more details), 2.1 Å

PDB Description: pyrone synthase (pys) from gerbera hybrida
PDB Compounds: (B:) pyrone synthase

SCOPe Domain Sequences for d1qlvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlvb2 c.95.1.2 (B:236-393) Pyrone synthase (PyS, chalcone synthase 2), C-terminal domain {Gerbera hybrid cultivar [TaxId: 18101]}
averpifeivstdqtilpdtekamklhlreggltfqlhrdvplmvaknienaaekalspl
gitdwnsvfwmvhpggraildqverklnlkedklrasrhvlseygnlisacvlfiidevr
krsmaegksttgegldcgvlfgfgpgmtvetvvlrsvr

SCOPe Domain Coordinates for d1qlvb2:

Click to download the PDB-style file with coordinates for d1qlvb2.
(The format of our PDB-style files is described here.)

Timeline for d1qlvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qlvb1