SCOPe 2.07: Domain d6gffk2: 6gff K:128-232

Lineage for d6gffk2 (6gff K:128-232)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d6gffk2: 6gff K:128-232 [360054]
Other proteins in same PDB: d6gffb_, d6gffd_, d6gfff_, d6gffh_, d6gffk1, d6gffm_
automated match to d2fd6l2
complexed with bma, man, nag

Details for d6gffk2

PDB Entry: 6gff (more details), 3.1 Å

PDB Description: structure of garp (lrrc32) in complex with latent tgf-beta1 and mhg-8 fab

PDB Compounds: (K:) MHG-8 Fab light chain

SCOPe Domain Sequences for d6gffk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gffk2 b.1.1.2 (K:128-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6gffk2:

Click to download the PDB-style file with coordinates for d6gffk2.
(The format of our PDB-style files is described here.)

Timeline for d6gffk2: