Lineage for d6gfff_ (6gff F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638479Protein TGF-beta1 [57512] (1 species)
  7. 2638480Species Human (Homo sapiens) [TaxId:9606] [57513] (6 PDB entries)
  8. 2638491Domain d6gfff_: 6gff F: [359859]
    Other proteins in same PDB: d6gffk1, d6gffk2, d6gffm_
    automated match to d3kfda_
    complexed with bma, man, nag

Details for d6gfff_

PDB Entry: 6gff (more details), 3.1 Å

PDB Description: structure of garp (lrrc32) in complex with latent tgf-beta1 and mhg-8 fab
PDB Compounds: (F:) Transforming growth factor beta-1

SCOPe Domain Sequences for d6gfff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfff_ g.17.1.2 (F:) TGF-beta1 {Human (Homo sapiens) [TaxId: 9606]}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

SCOPe Domain Coordinates for d6gfff_:

Click to download the PDB-style file with coordinates for d6gfff_.
(The format of our PDB-style files is described here.)

Timeline for d6gfff_: