Lineage for d6gffk1 (6gff K:21-127)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371317Domain d6gffk1: 6gff K:21-127 [360053]
    Other proteins in same PDB: d6gffb_, d6gffd_, d6gfff_, d6gffh_, d6gffk2
    automated match to d2fd6l1
    complexed with bma, man, nag

Details for d6gffk1

PDB Entry: 6gff (more details), 3.1 Å

PDB Description: structure of garp (lrrc32) in complex with latent tgf-beta1 and mhg-8 fab
PDB Compounds: (K:) MHG-8 Fab light chain

SCOPe Domain Sequences for d6gffk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gffk1 b.1.1.0 (K:21-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqvtqsssylsvslgdrvtitckasdhiknwlawyqqkpgiaprllvsgatsleagvps
rfsgsgsgknftlsitslqtedvatyycqqywstpwtfgggttleir

SCOPe Domain Coordinates for d6gffk1:

Click to download the PDB-style file with coordinates for d6gffk1.
(The format of our PDB-style files is described here.)

Timeline for d6gffk1: