Lineage for d6fogb_ (6fog B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. Protein automated matches [191123] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [359812] (2 PDB entries)
  8. Domain d6fogb_: 6fog B: [359813]
    automated match to d1sawb_
    complexed with cl, mg, oxl

Details for d6fogb_

PDB Entry: 6fog (more details), 1.94 Å

PDB Description: x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution.
PDB Compounds: (B:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6fogb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fogb_ d.177.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
diiltgtpkgvgpvkendeieagihglvsmtfkvekp

SCOPe Domain Coordinates for d6fogb_ are not available.

Timeline for d6fogb_:

Domains from other chains:
(mouse over for more information)
d6foga_, d6fogc_, d6fogd_, d6foge_, d6fogf_, d6fogg_, d6fogh_