Lineage for d6fogd_ (6fog D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004747Species Human (Homo sapiens) [TaxId:9606] [359812] (2 PDB entries)
  8. 3004753Domain d6fogd_: 6fog D: [360059]
    automated match to d1sawb_
    complexed with cl, mg, oxl

Details for d6fogd_

PDB Entry: 6fog (more details), 1.94 Å

PDB Description: x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution.
PDB Compounds: (D:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6fogd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fogd_ d.177.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrnl
hhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftas
cpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdii
ltgtpkgvgpvkendeieagihglvsmtfkvekpe

SCOPe Domain Coordinates for d6fogd_:

Click to download the PDB-style file with coordinates for d6fogd_.
(The format of our PDB-style files is described here.)

Timeline for d6fogd_: