Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (2 families) |
Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
Protein automated matches [191123] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [359812] (2 PDB entries) |
Domain d6fogg_: 6fog G: [359847] automated match to d1sawb_ complexed with cl, mg, oxl |
PDB Entry: 6fog (more details), 1.94 Å
SCOPe Domain Sequences for d6fogg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fogg_ d.177.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg diiltgtpkgvgpvkendeieagihglvsmtfkvekp
Timeline for d6fogg_: