PDB entry 6fog

View 6fog on RCSB PDB site
Description: X-ray structure of homo sapiens Fumarylacetoacetate hydrolase domain containing protein 1 (FAHD1) in complex with inhibitor oxalate at 1.94A resolution.
Class: hydrolase/lyase
Keywords: FAHD 1, Fumarylacetoacetate hydrolase domain containing protein 1, oxalate, inhibitor, hydrolase/lyase, hydrolase-lyase complex
Deposited on 2018-02-07, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6foga_
  • Chain 'B':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogb_
  • Chain 'C':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogc_
  • Chain 'D':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogd_
  • Chain 'E':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6foge_
  • Chain 'F':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogf_
  • Chain 'G':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogg_
  • Chain 'H':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fogh_
  • Heterogens: OXL, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fogA (A:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogA (A:)
    asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
    rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
    tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
    diiltgtpkgvgpvkendeieagihglvsmtfkvekpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fogB (B:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogB (B:)
    asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
    rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
    tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
    diiltgtpkgvgpvkendeieagihglvsmtfkvekp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fogC (C:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogC (C:)
    plsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrnl
    hhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftas
    cpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdii
    ltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fogD (D:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogD (D:)
    plsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrnl
    hhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftas
    cpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdii
    ltgtpkgvgpvkendeieagihglvsmtfkvekpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fogE (E:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogE (E:)
    rplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrn
    lhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksfta
    scpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdi
    iltgtpkgvgpvkendeieagihglvsmtfkvekp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fogF (F:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogF (F:)
    plsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrnl
    hhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftas
    cpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdii
    ltgtpkgvgpvkendeieagihglvsmtfkvekpe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fogG (G:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogG (G:)
    asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
    rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
    tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
    diiltgtpkgvgpvkendeieagihglvsmtfkvekp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fogH (H:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fogH (H:)
    asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
    rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
    tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
    diiltgtpkgvgpvkendeieagihglvsmtfkvekp