Lineage for d1sawb_ (1saw B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. Protein FAHD1 (Flj36880, YISKL) [118170] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [118171] (1 PDB entry)
    Uniprot Q6P587
  8. Domain d1sawb_: 1saw B: [112051]
    complexed with cl, mg

Details for d1sawb_

PDB Entry: 1saw (more details), 2.2 Å

PDB Description: X-ray structure of homo sapiens protein FLJ36880
PDB Compounds: (B:) hypothetical protein FLJ36880

SCOPe Domain Sequences for d1sawb_:

Sequence, based on SEQRES records: (download)

>d1sawb_ d.177.1.1 (B:) FAHD1 (Flj36880, YISKL) {Human (Homo sapiens) [TaxId: 9606]}
asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
diiltgtpkgvgpvkendeieagihglvsmtfkvekpey

Sequence, based on observed residues (ATOM records): (download)

>d1sawb_ d.177.1.1 (B:) FAHD1 (Flj36880, YISKL) {Human (Homo sapiens) [TaxId: 9606]}
asrplsrfwewgknivcvgrnyasepvlflkpstayapegspilmpaytrnlhhelelgv
vmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftascpvsafvp
kekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdiiltgtpkgv
gpvkendeieagihglvsmtfkvekpey

SCOPe Domain Coordinates for d1sawb_ are not available.

Timeline for d1sawb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sawa_