SCOPe 2.08: Domain d5nb0e2: 5nb0 E:115-228

Lineage for d5nb0e2 (5nb0 E:115-228)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual fold
Superfamily d.169.1: C-type lectin-like [56436] (9 families)
Family d.169.1.0: automated matches [191331] (1 protein)
not a true family
Protein automated matches [190159] (21 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
Domain d5nb0e2: 5nb0 E:115-228 [359382]
automated match to d1li1a2
complexed with cl

Details for d5nb0e2

PDB Entry: 5nb0 (more details), 2.7 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha3nc1

PDB Compounds: (E:) Collagen alpha-3(IV) chain

SCOPe Domain Sequences for d5nb0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb0e2 d.169.1.0 (E:115-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiaiavhsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspfl
echgrgtcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk

SCOPe Domain Coordinates for d5nb0e2:

Click to download the PDB-style file with coordinates for d5nb0e2.
(The format of our PDB-style files is described here.)

Timeline for d5nb0e2: