Lineage for d5nb0g2 (5nb0 G:115-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002634Domain d5nb0g2: 5nb0 G:115-228 [359330]
    automated match to d1li1a2
    complexed with cl

Details for d5nb0g2

PDB Entry: 5nb0 (more details), 2.7 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha3nc1
PDB Compounds: (G:) Collagen alpha-3(IV) chain

SCOPe Domain Sequences for d5nb0g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb0g2 d.169.1.0 (G:115-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiaiavhsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspfl
echgrgtcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk

SCOPe Domain Coordinates for d5nb0g2:

Click to download the PDB-style file with coordinates for d5nb0g2.
(The format of our PDB-style files is described here.)

Timeline for d5nb0g2: