SCOPe 2.08: Domain d1li1a2: 1li1 A:115-229

Lineage for d1li1a2 (1li1 A:115-229)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual fold
Superfamily d.169.1: C-type lectin-like [56436] (9 families)

Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
automatically mapped to Pfam PF01413

Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [75587] (5 PDB entries)
Domain d1li1a2: 1li1 A:115-229 [73899]
alpha 1 (chains A,B,D and E) and alpha 2 (chains C and F) isoforms
complexed with act

Details for d1li1a2

PDB Entry: 1li1 (more details), 1.9 Å

PDB Description: The 1.9-A crystal structure of the noncollagenous (NC1) domain of human placenta collagen IV shows stabilization via a novel type of covalent Met-Lys cross-link

PDB Compounds: (A:) Collagen alpha 1(IV)

SCOPe Domain Sequences for d1li1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li1a2 d.169.1.6 (A:115-229) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
amvmavhsqtiqippcpsgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt

SCOPe Domain Coordinates for d1li1a2:

Click to download the PDB-style file with coordinates for d1li1a2.
(The format of our PDB-style files is described here.)

Timeline for d1li1a2: