SCOPe 2.08: Domain d5nb0h2: 5nb0 H:115-228

Lineage for d5nb0h2 (5nb0 H:115-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d5nb0h2: 5nb0 H:115-228 [359333]
   automated match to d1li1a2
   complexed with cl

Details for d5nb0h2

PDB Entry: 5nb0, 2.7 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha3nc1

PDB Compounds: (H:) Collagen alpha-3(IV) chain

SCOPe Domain Sequences for d5nb0h2:

Sequence; same for both SEQRES and ATOM records:

>d5nb0h2 d.169.1.0 (H:115-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiaiavhsqttdippcphgwislwkgfsfimftsagsegtgqalaspgscleefraspfl
echgrgtcnyysnsysfwlaslnpermfrkpipstvkagelekiisrcqvcmkk

Timeline for d5nb0h2:

• d5nb0h2 first appeared in SCOPe 2.07