![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
![]() | Domain d5nb0f1: 5nb0 F:3-114 [359363] automated match to d1li1a1 complexed with cl |
PDB Entry: 5nb0 (more details), 2.7 Å
SCOPe Domain Sequences for d5nb0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nb0f1 d.169.1.0 (F:3-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} trgfvftrhsqttaipscpegtvplysgfsflfvqgnqrahgqdlgtlgsclqrfttmpf lfcnvndvcnfasrndysywlstpalmpmnmapitgralepyisrctvcegp
Timeline for d5nb0f1: