Lineage for d6g8mf_ (6g8m F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994374Domain d6g8mf_: 6g8m F: [357477]
    Other proteins in same PDB: d6g8mc2, d6g8me_, d6g8mg_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8mq2, d6g8ms_, d6g8mu_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_
    automated match to d4g4sg_
    complexed with cl, eqe, mg

Details for d6g8mf_

PDB Entry: 6g8m (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b derivative 1
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d6g8mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g8mf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d6g8mf_:

Click to download the PDB-style file with coordinates for d6g8mf_.
(The format of our PDB-style files is described here.)

Timeline for d6g8mf_: