SCOPe 2.08: Domain d6g8mb_: 6g8m B:

Lineage for d6g8mb_ (6g8m B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d6g8mb_: 6g8m B: [357427]
   Other proteins in same PDB: d6g8mc2, d6g8me_, d6g8mg_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8mq2, d6g8ms_, d6g8mu_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_
   automated match to d4cr2c_
   complexed with cl, eqe, mg

Details for d6g8mb_

PDB Entry: 6g8m, 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b derivative 1

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6g8mb_:

Sequence; same for both SEQRES and ATOM records:

>d6g8mb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d6g8mb_:

• d6g8mb_ first appeared in SCOPe 2.07