Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6g8mm_: 6g8m M: [357440] Other proteins in same PDB: d6g8mc2, d6g8me_, d6g8mg_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8mq2, d6g8ms_, d6g8mu_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_ automated match to d4j70m_ complexed with cl, eqe, mg |
PDB Entry: 6g8m (more details), 2.7 Å
SCOPe Domain Sequences for d6g8mm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g8mm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgyg
Timeline for d6g8mm_:
View in 3D Domains from other chains: (mouse over for more information) d6g8ma_, d6g8mb_, d6g8mc1, d6g8mc2, d6g8md_, d6g8me_, d6g8mf_, d6g8mg_, d6g8mh_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8mp_, d6g8mq1, d6g8mq2, d6g8mr_, d6g8ms_, d6g8mt_, d6g8mu_, d6g8mv_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_ |