SCOPe 2.08: Domain d6axta2: 6axt A:148-221

Lineage for d6axta2 (6axt A:148-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d6axta2: 6axt A:148-221 [357269]
   Other proteins in same PDB: d6axta1
   automated match to d2m8pa2
   complexed with cl, iod; mutant

Details for d6axta2

PDB Entry: 6axt, 2.4 Å

PDB Description: structure of the t58s/t107i/p122a mutant of the hiv-1 capsid protein

PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axta2:

Sequence; same for both SEQRES and ATOM records:

>d6axta2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d6axta2:

• d6axta2 first appeared in SCOPe 2.07