Lineage for d6axsa2 (6axs A:148-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706577Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. 2706610Domain d6axsa2: 6axs A:148-221 [357264]
    Other proteins in same PDB: d6axsa1
    automated match to d2m8pa2
    complexed with cl, iod; mutant

Details for d6axsa2

PDB Entry: 6axs (more details), 2.4 Å

PDB Description: structure of the v11i/t58a/p122a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6axsa2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d6axsa2:

Click to download the PDB-style file with coordinates for d6axsa2.
(The format of our PDB-style files is described here.)

Timeline for d6axsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6axsa1