Lineage for d5nblc2 (5nbl C:147-374)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2460927Protein Actin [53073] (10 species)
  7. 3056480Species Saccharomyces cerevisiae [TaxId:559292] [356542] (1 PDB entry)
  8. 3056482Domain d5nblc2: 5nbl C:147-374 [356544]
    Other proteins in same PDB: d5nble_, d5nblf_
    automated match to d1yaga2
    complexed with atp, ca

Details for d5nblc2

PDB Entry: 5nbl (more details), 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody
PDB Compounds: (C:) actin

SCOPe Domain Sequences for d5nblc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nblc2 c.55.1.1 (C:147-374) Actin {Saccharomyces cerevisiae [TaxId: 559292]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkc

SCOPe Domain Coordinates for d5nblc2:

Click to download the PDB-style file with coordinates for d5nblc2.
(The format of our PDB-style files is described here.)

Timeline for d5nblc2:

  • d5nblc2 is new in SCOPe 2.07-stable