SCOPe 2.08: Domain d5nblc2: 5nbl C:147-374

Lineage for d5nblc2 (5nbl C:147-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [356542] (1 PDB entry)

8. Domain d5nblc2: 5nbl C:147-374 [356544]
   Other proteins in same PDB: d5nble_, d5nblf_
   automated match to d1yaga2
   complexed with atp, ca

Details for d5nblc2

PDB Entry: 5nbl, 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody

PDB Compounds: (C:) actin

SCOPe Domain Sequences for d5nblc2:

Sequence; same for both SEQRES and ATOM records:

>d5nblc2 c.55.1.1 (C:147-374) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkc

Timeline for d5nblc2:

• d5nblc2 first appeared in SCOPe 2.07